Calpain 1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21673
- Images (1)
| Article Name: | Calpain 1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21673 |
| Supplier Catalog Number: | A21673 |
| Alternative Catalog Number: | ABB-A21673-20UL,ABB-A21673-100UL,ABB-A21673-500UL,ABB-A21673-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CANP, muCL, CANP1, SPG76, CANPL1, muCANP, Calpain 1 |
| The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 82kDa |
| NCBI: | 823 |
| UniProt: | P07384 |
| Purity: | Affinity purification |
| Sequence: | KQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEAFPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAAIASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHSAEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILKALERGSLLGCSIDISSVLDMEAITFKKLVKGHAY |
| Target: | CAPN1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Ubiquitin,Immunology Inflammation,T Cell Receptor Signaling Pathway,Neuroscience,Calcium Signaling,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Calpain 1 Rabbit pAb (A21673) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. |
Product Guarantee and Expert Support
