AKT1S1/PRAS40 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21686
Article Name: AKT1S1/PRAS40 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21686
Supplier Catalog Number: A21686
Alternative Catalog Number: ABB-A21686-20UL,ABB-A21686-100UL,ABB-A21686-500UL,ABB-A21686-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Lobe, PRAS40, AKT1S1/PRAS40
AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 84335
UniProt: Q96B36
Purity: Affinity purification
Sequence: STDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY
Target: AKT1S1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Signal Transduction,Kinase,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Cell Cycle,Endocrine Metabolism,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from PC-3 cells usingAKT1S1/PRAS40 Rabbit pAb (A21686) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.