STRADA Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21707
- Images (1)
| Article Name: | STRADA Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21707 |
| Supplier Catalog Number: | A21707 |
| Alternative Catalog Number: | ABB-A21707-100UL,ABB-A21707-20UL,ABB-A21707-1000UL,ABB-A21707-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | LYK5, PMSE, Stlk, STRAD, NY-BR-96, STRAD alpha, STRADA |
| The protein encoded by this gene contains a STE20-like kinase domain, but lacks several residues that are critical for catalytic activity, so it is termed a pseudokinase. The protein forms a heterotrimeric complex with serine/threonine kinase 11 (STK11, also known as LKB1) and the scaffolding protein calcium binding protein 39 (CAB39, also known as MO25). The protein activates STK11 leading to the phosphorylation of both proteins and excluding STK11 from the nucleus. The protein is necessary for STK11-induced G1 cell cycle arrest. A mutation in this gene has been shown to result in polyhydramnios, megalencephaly, and symptomatic epilepsy (PMSE) syndrome. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their full-length nature is not known. |
| Clonality: | Polyclonal |
| Molecular Weight: | 48kDa |
| NCBI: | 92335 |
| UniProt: | Q7RTN6 |
| Purity: | Affinity purification |
| Sequence: | FLPEGGCYELLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIADNELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVYLSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPE |
| Target: | STRADA |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Kinase,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,AMPK Signaling Pathway,Immunology Inflammation. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse skeletal muscle, using STRADA Rabbit pAb (A21707) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
