KLF4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21709
- Images (1)
| Article Name: | KLF4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21709 |
| Supplier Catalog Number: | A21709 |
| Alternative Catalog Number: | ABB-A21709-100UL,ABB-A21709-20UL,ABB-A21709-500UL,ABB-A21709-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | EZF, GKLF, KLF4 |
| This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Clonality: | Polyclonal |
| Molecular Weight: | 55kDa |
| NCBI: | 9314 |
| UniProt: | O43474 |
| Purity: | Affinity purification |
| Sequence: | PPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCG |
| Target: | KLF4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer,Tumor suppressors,Cell Biology Developmental Biology,Cell Cycle,Cell cycle inhibitors,Cell differentiation,Stem Cells,Embryonic Stem Cells,Cardiovascular,Heart,Hypertrophy. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using KLF4 Rabbit pAb (A21709) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
