Activator protein 2 (AP-2/TFAP2A) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21727
Article Name: Activator protein 2 (AP-2/TFAP2A) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21727
Supplier Catalog Number: A21727
Alternative Catalog Number: ABB-A21727-20UL,ABB-A21727-100UL,ABB-A21727-500UL,ABB-A21727-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AP-2, BOFS, AP2TF, TFAP2, AP-2alpha, Activator protein 2 (AP-2/TFAP2A)
The protein encoded by this gene is a transcription factor that binds the consensus sequence 5-GCCNNNGGC-3. The encoded protein functions as either a homodimer or as a heterodimer with similar family members. This protein activates the transcription of some genes while inhibiting the transcription of others. Defects in this gene are a cause of branchiooculofacial syndrome (BOFS). Three transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 7020
UniProt: P05549
Purity: Affinity purification
Sequence: RQSQESGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNL
Target: TFAP2A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using Activator protein 2 (AP-2/TFAP2A) Rabbit pAb (A21727) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.