Raptor Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21755
Article Name: Raptor Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21755
Supplier Catalog Number: A21755
Alternative Catalog Number: ABB-A21755-100UL,ABB-A21755-20UL,ABB-A21755-1000UL,ABB-A21755-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: KOG1, Mip1, Raptor
This gene encodes a component of a signaling pathway that regulates cell growth in response to nutrient and insulin levels. The encoded protein forms a stoichiometric complex with the mTOR kinase, and also associates with eukaryotic initiation factor 4E-binding protein-1 and ribosomal protein S6 kinase. The protein positively regulates the downstream effector ribosomal protein S6 kinase, and negatively regulates the mTOR kinase. Multiple transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 149kDa
NCBI: 57521
UniProt: Q8N122
Purity: Affinity purification
Sequence: LTNDVAKQPVSRDLPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRL
Target: RPTOR
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Autophagy,Cell Cycle,Cell cycle inhibitors,Endocrine Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Immunology Inflammation,T Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using Raptor Rabbit pAb (A21755) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.