AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21813
Article Name: AMPKalpha1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21813
Supplier Catalog Number: A21813
Alternative Catalog Number: ABB-A21813-100UL,ABB-A21813-20UL,ABB-A21813-500UL,ABB-A21813-1000UL
Manufacturer: ABclonal
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AMPK, AMPKa1, AMPK alpha 1, AMPKalpha1
The protein encoded by this gene belongs to the ser/thr protein kinase family. It is the catalytic subunit of the 5-prime-AMP-activated protein kinase (AMPK). AMPK is a cellular energy sensor conserved in all eukaryotic cells. The kinase activity of AMPK is activated by the stimuli that increase the cellular AMP/ATP ratio. AMPK regulates the activities of a number of key metabolic enzymes through phosphorylation. It protects cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. Alternatively spliced transcript variants encoding distinct isoforms have been observed.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 5562
UniProt: Q13131
Purity: Affinity purification
Sequence: IFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRL
Target: PRKAA1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Protein phosphorylation,Cancer,Signal Transduction,Kinase,Serine threonine kinases,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Autophagy,Endocrine Metabolism,Mitochondrial metabolism,Lipid Metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Warburg Effect,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular,Hypoxia,Lipids,Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from Mouse liver, using AMPKalpha1 Rabbit pAb (A21813) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.