PPP1CC Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A21818
- Images (1)
| Article Name: | PPP1CC Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A21818 |
| Supplier Catalog Number: | A21818 |
| Alternative Catalog Number: | ABB-A21818-20UL,ABB-A21818-100UL,ABB-A21818-500UL,ABB-A21818-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PP1C, PP-1G, PPP1G, PPP1CC |
| The protein encoded by this gene belongs to the protein phosphatase family, PP1 subfamily. PP1 is an ubiquitous serine/threonine phosphatase that regulates many cellular processes, including cell division. It is expressed in mammalian cells as three closely related isoforms, alpha, beta/delta and gamma, which have distinct localization patterns. This gene encodes the gamma isozyme. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Clonality: | Polyclonal |
| Molecular Weight: | 37kDa |
| NCBI: | 5501 |
| UniProt: | P36873 |
| Purity: | Affinity purification |
| Sequence: | MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGY |
| Target: | PPP1CC |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Cancer,Signal Transduction,Kinase,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Endocrine Metabolism,Lipid Metabolism,Insulin Receptor Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from 293T cells usingPPP1CC Rabbit pAb (A21818) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Product Guarantee and Expert Support
