[KO Validated] DDIT3/CHOP Rabbit mAb, Unconjugated, Monoclonal

Article Name:	[KO Validated] DDIT3/CHOP Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number:	ABB-A21902
Supplier Catalog Number:	A21902
Alternative Catalog Number:	ABB-A21902-20UL,ABB-A21902-100UL,ABB-A21902-500UL,ABB-A21902-1000UL
Manufacturer:	ABclonal
Host:	Rabbit
Category:	Antikörper
Application:	ELISA, IF, IHC-P, WB
Species Reactivity:	Human
Immunogen:	Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation:	Unconjugated
Alternative Names:	CHOP, CEBPZ, CHOP10, CHOP-10, GADD153, AltDDIT3, C/EBPzeta, DDIT3/CHOP

This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.

Clonality:	Monoclonal
Clone Designation:	[ARC51417]
Molecular Weight:	19 kDa
NCBI:	1649
UniProt:	P35638
Purity:	Affinity purification
Sequence:	MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG
Target:	DDIT3
Antibody Type:	Primary Antibody

Application Dilute:	WB,1:1000 - 1:2000\|IHC-P,1:100 - 1:1000\|IF/ICC,1:50 - 1:200\|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes:	Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Cell Biology Developmental Biology,Autophagy,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Stem Cells,Embryonic Stem Cells. Shipping: Ice Bag

	Western blot analysis of lysates from C2C12 cells using[KO Validated] DDIT3/CHOP Rabbit mAb (A21902) at1:900 dilution incubated overnight at 4°C. C2C12 cells were treated with tunicamycin (2 µg/ml) for 8 hours Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:20s.
	Western blot analysis of lysates from wild type (WT) and DDIT3/CHOP knockout (KO) HeLa cells using [KO Validated] DDIT3/CHOP Rabbit mAb (A21902) at 1:1000 dilution incubated overnight at 4°C. HeLa cells were treated with Tunicamycin (20 µg/mL) at 37°C for 3 hrs. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
	Western blot analysis of lysates from C6 cells using[KO Validated] DDIT3/CHOP Rabbit mAb (A21902) at1:900 dilution incubated overnight at 4°C. C6 cells were treated with tunicamycin (2 µg/ml) for 8 hours Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:60s.
	Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using [KO Validated] DDIT3/CHOP Rabbit mAb (A21902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embedded Human placenta tissue using [KO Validated] DDIT3/CHOP Rabbit mAb (A21902) at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
	Confocal imaging of C2C12 cells (treated with Tunicamycin) and C2C12 cells (untreated) cells using [KO Validated] DDIT3/CHOP Rabbit mAb(A21902, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
	Confocal imaging of C6 cells (treated with Tunicamycin) and C6 cells (untreated) using [KO Validated] DDIT3/CHOP Rabbit mAb (A21902, dilution 1:200) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 100x.
	Immunofluorescence analysis of C2C12 cells (treated with Tunicamycan) and C2C12 cells (untreated) using [KO Validated] DDIT3/CHOP Rabbit mAb (A21902) at a dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.