PDLIM5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22013
Article Name: PDLIM5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22013
Supplier Catalog Number: A22013
Alternative Catalog Number: ABB-A22013-20UL,ABB-A22013-100UL,ABB-A22013-500UL,ABB-A22013-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: L9, ENH, LIM, ENH1, PDLIM5
This gene encodes a member of a family of proteins that possess a 100-amino acid PDZ domain at the N terminus and one to three LIM domains at the C-terminus. This family member functions as a scaffold protein that tethers protein kinases to the Z-disk in striated muscles. It is thought to function in cardiomyocyte expansion and in restraining postsynaptic growth of excitatory synapses. Alternative splicing of this gene results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 10611
UniProt: Q96HC4
Purity: Affinity purification
Sequence: ADNTKKANNSQEPSPQLASSVASTRSMPESLDSPTSGRPGVTSLTAAAAFKPVGSTGVIKSPSWQRPNQGVPSTGRISNSATYSGSVAPANSALGQTQPSD
Target: PDLIM5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Kinase,Cell Biology Developmental Biology,Cytoskeleton,Microfilaments,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of lysates from HeLa cells, using PDLIM5 Rabbit pAb (A22013) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.