MFSD2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22116
Article Name: MFSD2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22116
Supplier Catalog Number: A22116
Alternative Catalog Number: ABB-A22116-100UL,ABB-A22116-20UL,ABB-A22116-500UL,ABB-A22116-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NLS1, MFSD2, MCPH15, SLC59A1, HsMFSD2A, NEDMISBA, MFSD2A
The protein encoded by this gene is a transmembrane protein and sodium-dependent lysophosphatidylcholine transporter. The encoded protein is involved in the establishment of the blood-brain barrier and is required for brain growth and function. Defects in this gene are a cause of a progressive microcephaly syndrome.
Clonality: Polyclonal
Molecular Weight: 60 kDa
NCBI: 84879
UniProt: Q8NA29
Purity: Affinity purification
Sequence: DFAGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL
Target: MFSD2A
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor suppressors,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using MFSD2A Rabbit pAb (A22116) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.