pan-Trk Rabbit pAb, Polyclonal

Catalog Number: ABB-A22121
Article Name: pan-Trk Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A22121
Supplier Catalog Number: A22121
Alternative Catalog Number: ABB-A22121-20UL,ABB-A22121-100UL,ABB-A22121-1000UL,ABB-A22121-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Neurotrophic tyrosine kinase (NTRK) is a family of receptor tyrosine kinase.The NTRK gene family contains three members, NTRK1, NTRK2 and NTRK3, which produce TRKA, TRKB and TRKC proteins, respectively.TRK kinases leads to cell differentiation and may play important roles in normal neural functions.Rearrangements in the NTRK genes can result in two genes fusing together and producing altered TRK proteins, which can lead to uncontrolled growth of cancer cells. Neurotrophic tyrosine receptor kinase (NTRK) gene fusions are an actionable biomarker for cancer therapy and can be found in over 25 different types of cancer.
Clonality: Polyclonal
NCBI: 4914
UniProt: P04629
Purity: Affinity purification
Sequence: ESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG
Target: NTRK1/NTRK2/NTRK3
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Protein phosphorylation,Cancer,Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Growth factors,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using pan-Trk Rabbit pAb (A22121) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.