CBX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2247
Article Name: CBX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2247
Supplier Catalog Number: A2247
Alternative Catalog Number: ABB-A2247-20UL,ABB-A2247-100UL,ABB-A2247-500UL,ABB-A2247-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CBX, M31, MOD1, p25beta, HP1-BETA, HP1Hsbeta, HP1Hs-beta, CBX1
This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 10951
UniProt: P83916
Purity: Affinity purification
Sequence: MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKP
Target: CBX1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of lysates from OVCAR-3 cells, using CBX1 Rabbit pAb (A2247) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.