ALDH1A1 Rabbit PolymAb, Unconjugated, Monoclonal

Catalog Number: ABB-A22531PM
Article Name: ALDH1A1 Rabbit PolymAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A22531PM
Supplier Catalog Number: A22531PM
Alternative Catalog Number: ABB-A22531PM-100UL,ABB-A22531PM-500UL,ABB-A22531PM-20UL,ABB-A22531PM-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ALDC, ALDH1, HEL-9, HEL12, PUMB1, ALDH11, RALDH1, ALDH-E1, HEL-S-53e
The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet.
Clonality: Monoclonal
Molecular Weight: 55kDa
NCBI: 216
UniProt: P00352
Purity: Affinity purification
Sequence: VGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
Target: ALDH1A1
Application Dilute: WB,1:10000 - 1:60000|IHC-P,1:100 - 1:500|IF/ICC,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Neuroscience, Cell Type Marker,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease,Stem Cells,Hematopoietic Progenitors,Neuron marker. Shipping: Ice Bag
Western blot analysis of lysates from rat lung, using ALDH1A1 Rabbit PolymAb (A22531PM) at 1:50000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25µg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
Western blot analysis of various lysates, using ALDH1A1 Rabbit PolymAb (A22531PM) at 1:50000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): THP-1
Exposure time: 20s.
Immunohistochemistry analysis of paraffin-embedded Human liver cancer using ALDH1A1 Rabbit PolymAb (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil using ALDH1A1 Rabbit PolymAb (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse testis using ALDH1A1 Rabbit PolymAb (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat kidney using ALDH1A1 Rabbit PolymAb (A22531PM) at dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of A-549 cells using ALDH1A1 Rabbit PolymAb (A22531PM) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using ALDH1A1 Rabbit PolymAb (A22531PM) at dilution of 1:800 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.