MFAP5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22675
Article Name: MFAP5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22675
Supplier Catalog Number: A22675
Alternative Catalog Number: ABB-A22675-20UL,ABB-A22675-100UL,ABB-A22675-500UL,ABB-A22675-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: AAT9, MP25, MAGP2, MAGP-2, MFAP-5, MFAP5
This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 8076
UniProt: Q13361
Purity: Affinity purification
Sequence: ASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
Target: MFAP5
Antibody Type: Primary Antibody
Application Dilute: WB,1:3000 - 1:12000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Growth factors,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using MFAP5 Rabbit pAb (A22675) at 1:3000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10 s.