Siglec1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22677
Article Name: Siglec1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22677
Supplier Catalog Number: A22677
Alternative Catalog Number: ABB-A22677-100UL,ABB-A22677-20UL,ABB-A22677-500UL,ABB-A22677-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Sn, Cd169, Siglec-1, Siglec1
Predicted to enable virion binding activity. Acts upstream of or within positive regulation of T cell apoptotic process and positive regulation of extrinsic apoptotic signaling pathway. Predicted to be located in extracellular region and membrane. Predicted to be integral component of membrane. Predicted to be active in early endosome, late endosome, and plasma membrane. Is expressed in immune system, reproductive system, and skin. Orthologous to human SIGLEC1 (sialic acid binding Ig like lectin 1).
Clonality: Polyclonal
Molecular Weight: 183kDa
NCBI: 20612
UniProt: Q62230
Purity: Affinity purification
Sequence: TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTD
Target: Siglec1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Tags & Cell Markers,Cell Type Markers,Neuroscience Markers. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen usingSiglec1 Rabbit pAb (A22677) at1:700 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.