[KD Validated] YTHDC1 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A22992
Article Name: [KD Validated] YTHDC1 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A22992
Supplier Catalog Number: A22992
Alternative Catalog Number: ABB-A22992-100UL,ABB-A22992-500UL,ABB-A22992-20UL,ABB-A22992-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: YT521, YT521-B, [KD Validated] YTHDC1
Enables N6-methyladenosine-containing RNA binding activity. Involved in mRNA export from nucleus, mRNA splice site selection, and regulation of gene expression. Located in nuclear speck and plasma membrane.
Clonality: Monoclonal
Clone Designation: [ARC59465]
Molecular Weight: 85kDa
NCBI: 91746
UniProt: Q96MU7
Purity: Affinity purification
Sequence: MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVS
Target: YTHDC1
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:8000|IHC-P,1:500 - 1:5000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and YTHDC1 knockdown (KD) HeLa cells using [KD Validated] YTHDC1 Rabbit mAb (A22992) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embeddedMouse colon tissue using[KD Validated] YTHDC1 Rabbit mAb(A22992) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Western blot analysis of various lysates using [KD Validated] YTHDC1 Rabbit mAb (A22992) at 1:2000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunohistochemistry analysis of paraffin-embeddedHuman thyroid cancer tissue using[KD Validated] YTHDC1 Rabbit mAb(A22992) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue using[KD Validated] YTHDC1 Rabbit mAb(A22992) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman small intestine tissue using[KD Validated] YTHDC1 Rabbit mAb(A22992) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman esophagus tissue using[KD Validated] YTHDC1 Rabbit mAb(A22992) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman breast cancer tissue using[KD Validated] YTHDC1 Rabbit mAb(A22992) at a dilution of 1:1000 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.