IL12B Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23054
- Images (1)
| Article Name: | IL12B Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23054 |
| Supplier Catalog Number: | A23054 |
| Alternative Catalog Number: | ABB-A23054-500UL,ABB-A23054-100UL,ABB-A23054-20UL,ABB-A23054-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | p40, Il-12b, Il12p40, Il-12p40, IL12B |
| This gene encodes the beta subunit p40 of the Interleukin 12 (IL-12) family of cytokines. Members of the IL-12 family form heterodimers consisting of heavy and light subunits linked by disulfide bonds. The product of this gene, p40, is a subunit of interleukins IL-12 and IL-23. |
| Clonality: | Polyclonal |
| Molecular Weight: | 38kDa |
| NCBI: | 16160 |
| UniProt: | P43432 |
| Purity: | Affinity purification |
| Sequence: | MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRK |
| Target: | Il12b |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using IL12B Rabbit pAb (A23054) at 1:800 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Product Guarantee and Expert Support
