PDE4B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23257
Article Name: PDE4B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23257
Supplier Catalog Number: A23257
Alternative Catalog Number: ABB-A23257-20UL,ABB-A23257-100UL,ABB-A23257-1000UL,ABB-A23257-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DPDE4, PDEIVB, PDE4B
This gene is a member of the type IV, cyclic AMP (cAMP)-specific, cyclic nucleotide phosphodiesterase (PDE) family. The encoded protein regulates the cellular concentrations of cyclic nucleotides and thereby play a role in signal transduction. Altered activity of this protein has been associated with schizophrenia and bipolar affective disorder. Alternative splicing and the use of alternative promoters results in multiple transcript variants encoding different isoforms.
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 5142
UniProt: Q07343
Purity: Affinity purification
Sequence: PDAQDILDTLEDNRNWYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT
Target: PDE4B
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung, using PDE4B Rabbit pAb (A23257) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.