CD107b Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23260
- Images (1)
| Article Name: | CD107b Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23260 |
| Supplier Catalog Number: | A23260 |
| Alternative Catalog Number: | ABB-A23260-100UL,ABB-A23260-500UL,ABB-A23260-20UL,ABB-A23260-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | Mac3, LGP-B, CD107b, Lamp-2, Lamp II, Lamp-2a, Lamp-2b, Lamp-2c |
| Enables protein domain specific binding activity. Involved in several processes, including autophagosome maturation, protein stabilization, and protein targeting to lysosome involved in chaperone-mediated autophagy. Acts upstream of or within muscle cell cellular homeostasis. Located in late endosome membrane, lysosomal membrane, and phagocytic vesicle membrane. Is integral component of autophagosome membrane. Is expressed in central nervous system, egg cylinder, lung, and retina. Used to study Danon disease. Human ortholog(s) of this gene implicated in Danon disease and hypertrophic cardiomyopathy. Orthologous to human LAMP2 (lysosomal associated membrane protein 2). |
| Clonality: | Polyclonal |
| Molecular Weight: | 46kDa |
| NCBI: | 16784 |
| UniProt: | P17047 |
| Purity: | Affinity purification |
| Sequence: | LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQ |
| Target: | Lamp2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using CD107b Rabbit pAb (A23260) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s. |
Product Guarantee and Expert Support
