Cleaved Caspase-1 p20 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A23429
Article Name: Cleaved Caspase-1 p20 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A23429
Supplier Catalog Number: A23429
Alternative Catalog Number: ABB-A23429-20UL,ABB-A23429-1000UL,ABB-A23429-100UL,ABB-A23429-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ICE, P45, IL1BC, Caspase-1 p20
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce 2 subunits, large and small, that dimerize to form the active enzyme. This gene was identified by its ability to proteolytically cleave and activate the inactive precursor of interleukin-1, a cytokine involved in the processes such as inflammation, septic shock, and wound healing. This gene has been shown to induce cell apoptosis and may function in various developmental stages. Studies of a similar gene in mouse suggest a role in the pathogenesis of Huntington disease. Alternative splicing results in transcript variants encoding distinct isoforms.
Clonality: Monoclonal
Clone Designation: [ARC60705]
Molecular Weight: 10KDa/29KDa/35KDa/42KDa/45KDa
NCBI: 834
UniProt: P29466
Purity: Affinity purification
Sequence: DVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
Target: CASP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:8000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,ErbB-HER Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Caspases,Endocrine Metabolism,Immunology Inflammation,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag
Western blot analysis of lysates from THP-1 cells using Cleaved Caspase-1 p20 Rabbit mAb (A23429) at 1:2000 dilution. THP-1 cells were treated with PMA/TPA (80 nM) at 37°C for overnight and LPS (1 µg/ml) at 37°C for 6 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.