Uhrf2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A2344
- Images (1)
| Article Name: | Uhrf2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A2344 |
| Supplier Catalog Number: | A2344 |
| Alternative Catalog Number: | ABB-A2344-20UL,ABB-A2344-1000UL,ABB-A2344-500UL,ABB-A2344-100UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | Nirf, 2310065A22Rik, D130071B19Rik, Uhrf2 |
| Enables histone binding activity. Predicted to be involved in several processes, including maintenance of DNA methylation, protein autoubiquitination, and regulation of cell cycle. Located in heterochromatin and nucleus. Is expressed in several structures, including central nervous system, ear, early conceptus, female reproductive system, and urinary system. Orthologous to human UHRF2 (ubiquitin like with PHD and ring finger domains 2). |
| Clonality: | Polyclonal |
| Molecular Weight: | 90kDa |
| NCBI: | 109113 |
| UniProt: | Q7TMI3 |
| Purity: | Affinity purification |
| Sequence: | DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDP |
| Target: | Uhrf2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology & Developmental Biology,Apoptosis,Cell Cycle,Cell cycle inhibitors,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse thymus, using Uhrf2 Rabbit pAb (A2344) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
