TIMM13 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A23597
Article Name: TIMM13 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A23597
Supplier Catalog Number: A23597
Alternative Catalog Number: ABB-A23597-1000UL,ABB-A23597-100UL,ABB-A23597-20UL,ABB-A23597-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ppv1, TIM13, TIM13B, TIMM13A, TIMM13B, TIMM13
This gene encodes a member of the evolutionarily conserved TIMM (translocase of inner mitochondrial membrane) family of proteins that function as chaperones in the import of proteins from the cytoplasm into the mitochondrial inner membrane. Proteins of this family play a role in collecting substrate proteins from the translocase of the outer mitochondrial membrane (TOM) complex and delivering them to either the sorting and assembly machinery in the outer mitochondrial membrane (SAM) complex or the TIMM22 complex in the inner mitochondrial membrane. The encoded protein and the translocase of mitochondrial inner membrane 8a protein form a 70 kDa complex in the intermembrane space.
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 26517
UniProt: Q9Y5L4
Purity: Affinity purification
Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM
Target: TIMM13
Application Dilute: WB,1:2000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from Rat kidney, using TIMM13 Rabbit pAb (A23597) at 1:4000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.