CD97 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23662
- Images (1)
| Article Name: | CD97 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23662 |
| Supplier Catalog Number: | A23662 |
| Alternative Catalog Number: | ABB-A23662-100UL,ABB-A23662-1000UL,ABB-A23662-500UL,ABB-A23662-20UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | Cd97, TM7LN1, CD97 |
| Predicted to enable G protein-coupled receptor activity and chondroitin sulfate binding activity. Acts upstream of or within positive regulation of synapse assembly. Located in external side of plasma membrane. Is expressed in several structures, including central nervous system, eye, genitourinary system, gut, and immune system. Human ortholog(s) of this gene implicated in vibratory urticaria. Orthologous to several human genes including ADGRE5 (adhesion G protein-coupled receptor E5). |
| Clonality: | Polyclonal |
| Molecular Weight: | 90kDa |
| NCBI: | 26364 |
| UniProt: | Q9Z0M6 |
| Purity: | Affinity purification |
| Sequence: | QKAESKNCAKWCPINSKCVSNRSCVCKPGFSSEKELITNPAESCEDINECLLPGFSCGDFAMCKNSEGSYTCVCNLGYKLLSGAESFVNESENTCQASVNTGMTPVPSRIHTVTTAPGNLPEQTTTVHQTQMGDSEERTPKDVNECISGQNHCHQSTHCINKLGGYSCICRQGWKPVPGSPNGPVSTVCEDVDECSSGQHQCHNSTVCKNTVGSYKCHCRPGWKPTSGSLRGPDTICQEPPF |
| Target: | Adgre5 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse lung, using CD97 Rabbit pAb (A23662) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
