ACAD8 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23663
- Images (1)
| Article Name: | ACAD8 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23663 |
| Supplier Catalog Number: | A23663 |
| Alternative Catalog Number: | ABB-A23663-500UL,ABB-A23663-100UL,ABB-A23663-1000UL,ABB-A23663-20UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | IBDH, ARC42, ACAD-8, ACAD8 |
| This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functions in catabolism of the branched-chain amino acid valine. Defects in this gene are the cause of isobutyryl-CoA dehydrogenase deficiency. |
| Clonality: | Polyclonal |
| Molecular Weight: | 45kDa |
| NCBI: | 27034 |
| UniProt: | Q9Z0M6 |
| Purity: | Affinity purification |
| Sequence: | VQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTTAYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQGDHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRI |
| Target: | ACAD8 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:2000 - 1:7000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using ACAD8 Rabbit pAb (A23663) at 1:6000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
