Chek2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23664
- Images (1)
| Article Name: | Chek2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23664 |
| Supplier Catalog Number: | A23664 |
| Alternative Catalog Number: | ABB-A23664-500UL,ABB-A23664-1000UL,ABB-A23664-20UL,ABB-A23664-100UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CHK2, Cds1, Rad53, HUCDS1, Chek2 |
| Enables protein kinase activity. Acts upstream of or within cellular response to gamma radiation, peptidyl-serine phosphorylation, and signal transduction by p53 class mediator. Predicted to be located in Golgi apparatus and PML body. Predicted to be active in cytoplasm and nucleus. Predicted to colocalize with chromosome, telomeric region. Is expressed in several structures, including central nervous system, genitourinary system, and liver. Human ortholog(s) of this gene implicated in several diseases, including Li-Fraumeni syndrome 2, breast cancer (multiple), colorectal cancer, osteosarcoma, and prostate cancer. Orthologous to human CHEK2 (checkpoint kinase 2). |
| Clonality: | Polyclonal |
| Molecular Weight: | 61kDa |
| NCBI: | 50883 |
| UniProt: | Q9Z265 |
| Purity: | Affinity purification |
| Sequence: | MKSHHQSHSSTSSKAHDSASCSQSQGGFSQPQGTPSQLHELSQYQGSSSSSTGTVPSSSQSSHSSSGTLSSLETVSTQELCSIPEDQEPEEPGPAPWARLWALQDGFSNLDCVNDNYWFGRDKSCEYCFDGPLLRRTDKYRTYSKKHFRIFREMGPKNCYIVYIEDHSGNGTFVNTELIGKGKRCPLSNNSEIALSLCRNKVFVFFDLTVDDQSV |
| Target: | Chek2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Chek2 Rabbit pAb (A23664) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
