TIMM29 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A23671
- Images (1)
| Article Name: | TIMM29 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A23671 |
| Supplier Catalog Number: | A23671 |
| Alternative Catalog Number: | ABB-A23671-500UL,ABB-A23671-100UL,ABB-A23671-1000UL,ABB-A23671-20UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | TIM29, C19orf52, TIMM29 |
| Enables protein transporter activity. Involved in protein insertion into mitochondrial inner membrane. Located in mitochondrial inner membrane and mitochondrial intermembrane space. Part of TIM22 mitochondrial import inner membrane insertion complex. |
| Clonality: | Polyclonal |
| Molecular Weight: | 29kDa |
| NCBI: | 90580 |
| UniProt: | Q9BSF4 |
| Purity: | Affinity purification |
| Sequence: | PSEGAFEEALLEASGTLLLLAPATRNRESEAFVQRLLWLRGRGRLRYVNLGLCSLVYEAPFDAQASLYQARCRYLQPRWTDFPGRVLDVGFVGRWWVLGAWMRDCDINDDEFLHLPAHLRVVGPQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQAHSLVQAEAPR |
| Target: | TIMM29 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using TIMM29 Rabbit pAb (A23671) at 1:500 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Product Guarantee and Expert Support
