Synapsin-1 Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A24122
Article Name: Synapsin-1 Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A24122
Supplier Catalog Number: A24122
Alternative Catalog Number: ABB-A24122-100UL,ABB-A24122-1000UL,ABB-A24122-500UL,ABB-A24122-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: SYNI, EPILX, MRX50, SYN1a, SYN1b, EPILX1, Synapsin-1
This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family plays a role in regulation of axonogenesis and synaptogenesis. The protein encoded serves as a substrate for several different protein kinases and phosphorylation may function in the regulation of this protein in the nerve terminal. Mutations in this gene may be associated with X-linked disorders with primary neuronal degeneration such as Rett syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified.
Clonality: Monoclonal
Clone Designation: [ARC65381]
Molecular Weight: 74kDa
NCBI: 6853
UniProt: P17600
Purity: Affinity purification
Sequence: EDKQLIVELVVNKMAQALPRQRQRDASPGRGSHGQTPSPGALPLGRQTSQQPAGPPAQQRPPPQGGPPQPGPGPQRQGPPLQQRPPPQGQQHLSGLGPPA
Target: SYN1
Antibody Type: Primary Antibody
Application Dilute: WB,1:3000 - 1:12000|IF-P,1:200 - 1:800|IHC-P,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Protein phosphorylation,Signal Transduction,G protein signaling,G-Protein-Coupled Receptors Signaling to MAPK Erk,Neuroscience, Cell Type Marker,Neuron marker,Synapse marker. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue usingSynapsin-1 Rabbit mAb(A24122) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedRat brain tissue usingSynapsin-1 Rabbit mAb(A24122) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Western blot analysis of lysates from SH-SY5Y cells using Synapsin-1 Rabbit mAb (A24122) at 1:5000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embeddedMouse colon tissue usingSynapsin-1 Rabbit mAb(A24122) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedMouse brain tissue usingSynapsin-1 Rabbit mAb(A24122) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embeddedHuman brain tissue usingSynapsin-1 Rabbit mAb(A24122) at a dilution of 1:800 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging ofparaffin-embedded Rat brain usingSynapsin-1 Rabbit mAb (A24122,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging ofparaffin-embedded Mouse brain usingSynapsin-1 Rabbit mAb (A24122,dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007,dilution 1:500)(Red).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.