MMP9 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24220
- Images (1)
| Article Name: | MMP9 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24220 |
| Supplier Catalog Number: | A24220 |
| Alternative Catalog Number: | ABB-A24220-500UL,ABB-A24220-100UL,ABB-A24220-1000UL,ABB-A24220-20UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | Clg4b, Gel B, MMP-9, B/MMP9, pro-MMP-9, Pro-MMP9 |
| This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme that degrades collagens of type IV, V and XI, and elastin. Mice lacking the encoded protein exhibit an abnormal pattern of skeletal growth plate vascularization and ossification, reduced keratinocyte hyperproliferation at all neoplastic stages, a decreased incidence of invasive tumors, and resistance to experimental autoimmune encephalomyelitis. |
| Clonality: | Polyclonal |
| Molecular Weight: | 80KDa |
| NCBI: | 17395 |
| UniProt: | P41245 |
| Purity: | Affinity purification |
| Sequence: | FQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCT |
| Target: | MMP9 |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Cardiovascular Angiogenesis Adhesion / ECM Matrix Metalloproteinases MMP, Signal Transduction Cytoskeleton / ECM Extracellular Matrix ECM Enzymes MMP,Cancer Tumor biomarkers Enzymes MMPs. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse spleen usingMMP9 Rabbit pAb (A24220) at1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
