RAP1B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24472
Article Name: RAP1B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24472
Supplier Catalog Number: A24472
Alternative Catalog Number: ABB-A24472-20UL,ABB-A24472-100UL,ABB-A24472-1000UL,ABB-A24472-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: RAP1B, K-REV, RAL1B, ras-related protein Rap-1b
This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9.
Clonality: Polyclonal
Molecular Weight: 15kDa/16kDa/18kDa/20kDa
NCBI: 5908
UniProt: P61224
Purity: Affinity purification
Sequence: VYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSSC
Target: RAP1B
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,Signal Transduction,G2/M DNA Damage Checkpoint,MAPK-Erk Signaling Pathway,Cell Biology & Developmental Biology,Cell Adhesion,Endocrine & Metabolism,Immunology & Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from Rat brain, using RAP1B Rabbit pAb (A24472) at 1:400 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.