PKACalpha Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24483
Article Name: PKACalpha Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24483
Supplier Catalog Number: A24483
Alternative Catalog Number: ABB-A24483-20UL,ABB-A24483-100UL,ABB-A24483-1000UL,ABB-A24483-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PRKACA, PKACA, PPNAD4, cAMP-dependent protein kinase catalytic subunit alpha, PKACalpha
This gene encodes one of the catalytic subunits of protein kinase A, which exists as a tetrameric holoenzyme with two regulatory subunits and two catalytic subunits, in its inactive form. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. cAMP-dependent phosphorylation of proteins by protein kinase A is important to many cellular processes, including differentiation, proliferation, and apoptosis. Constitutive activation of this gene caused either by somatic mutations, or genomic duplications of regions that include this gene, have been associated with hyperplasias and adenomas of the adrenal cortex and are linked to corticotropin-independent Cushings syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. Tissue-specific isoforms that differ at the N-terminus have been described, and these isoforms may differ in the post-translational modifications that occur at the N-terminus of some isoforms.
Clonality: Polyclonal
Molecular Weight: 39kDa/40kDa
NCBI: 5566
UniProt: P17612
Purity: Affinity purification
Sequence: IVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Target: PRKACA
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,G protein signaling,G2/M DNA Damage Checkpoint,Kinase,Serine/threonine kinases,MAPK-Erk Signaling Pathway,Cell Biology & Developmental Biology,Apoptosis,Mitochondrial Control of Apoptosis,Inhibition of Apoptosis,Cell Cycle,Centrosome,Cytoskeleton,Microtubules,Actins,Hedgehog Signaling Pathway,Endocrine & Metabolism,Lipid Metabolism,Carbohydrate metabolism,AMPK Signaling Pathway,Insulin Receptor Signaling Pathway,Immunology & Inflammation,NF-kB Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of various lysates, using PKACalpha Rabbit pAb (A24483) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.