NAPSA Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24485
Article Name: NAPSA Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24485
Supplier Catalog Number: A24485
Alternative Catalog Number: ABB-A24485-100UL,ABB-A24485-20UL,ABB-A24485-1000UL,ABB-A24485-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NAPSA, KAP, Kdap, NAP1, NAPA, SNAPA, napsin-A
This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma.
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 9476
UniProt: O96009
Purity: Affinity purification
Sequence: KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLG
Target: NAPSA
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Rat. ResearchArea: Cell Biology & Developmental Biology,Ubiquitin. Shipping: Ice Bag
Western blot analysis of lysates from Rat lung, using NAPSA Rabbit pAb (A24485) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.