CD105 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24488
- Images (1)
| Article Name: | CD105 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24488 |
| Supplier Catalog Number: | A24488 |
| Alternative Catalog Number: | ABB-A24488-100UL,ABB-A24488-20UL,ABB-A24488-1000UL,ABB-A24488-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | Endo, CD105, S-endoglin |
| Enables protein homodimerization activity and transforming growth factor beta binding activity. Involved in several processes, including circulatory system development, positive regulation of cell differentiation, and regulation of gene expression. Acts upstream of or within circulatory system development and positive regulation of angiogenesis. Located in endothelial microparticle. Is expressed in several structures, including brain, cardiovascular system, extraembryonic vascular system, and lung. Used to study arteriovenous malformations of the brain and hereditary hemorrhagic telangiectasia. Human ortholog(s) of this gene implicated in arteriovenous malformation, arteriovenous malformations of the brain, breast cancer, hereditary hemorrhagic telangiectasia, and intracranial aneurysm. Orthologous to human ENG (endoglin). |
| Clonality: | Polyclonal |
| Molecular Weight: | 70kDa |
| NCBI: | 13805 |
| UniProt: | Q63961 |
| Purity: | Affinity purification |
| Sequence: | ERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVSWFIDINHSMQILTTGEYSVKI |
| Target: | Eng |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using CD105 Rabbit pAb (A24488) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Negative control (NC):NIH/3T3 Exposure time: 5s. |
Product Guarantee and Expert Support
