GTF2IRD1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24506
- Images (1)
| Article Name: | GTF2IRD1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24506 |
| Supplier Catalog Number: | A24506 |
| Alternative Catalog Number: | ABB-A24506-20UL,ABB-A24506-100UL,ABB-A24506-500UL,ABB-A24506-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GTF2IRD1, BEN, CREAM1, GTF3, MUSTRD1, RBAP2, WBS, WBSCR11, WBSCR12, hMusTRD1alpha1, GTF2I repeat domain containing 1 |
| The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene plays a role in craniofacial and cognitive development and mutations have been associated with Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 104kDa/106kDa/107kDa |
| NCBI: | 9569 |
| UniProt: | Q9UHL9 |
| Purity: | Affinity purification |
| Sequence: | SLGFSPPALPPERDSGDPLVDESLKRQGFQENYDARLSRIDIANTLREQVQDLFNKKYGEALGIKYPVQVPYKRIKSNPGSVIIEGLPPGIPFRKPCTFGSQNLERILAVADKIKFTVTRPFQGLIPKPDEDDANRLGEKVILREQVKELFNEKYGEALGLNRPVLVPYKLIRDSPDAVEVTGLPDDIPFRNPNTYDIHRLEKILKAREHVRMVIINQLQPFAEICNDAKV |
| Target: | GTF2IRD1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:100 - 1:500|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat liver, using GTF2IRD1 Rabbit pAb (A24506) at 1:400 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
