CD132 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24525
- Images (1)
| Article Name: | CD132 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24525 |
| Supplier Catalog Number: | A24525 |
| Alternative Catalog Number: | ABB-A24525-20UL,ABB-A24525-100UL,ABB-A24525-500UL,ABB-A24525-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | gc, p64, [g]c, CD132, gamma(c) |
| This gene encodes a transmembrane protein that is a common subunit of several interleukin receptor complexes. These receptors are comprised of alpha and beta subunits in addition to this gamma subunit. Signalling through this pathway in important in immune cell differentiation and function. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 42kDa |
| NCBI: | 16186 |
| UniProt: | P34902 |
| Purity: | Affinity purification |
| Sequence: | WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA |
| Target: | Il2rg |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Rat. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat spleen, using CD132 Rabbit pAb (A24525) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
