CD53 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24527
Article Name: CD53 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24527
Supplier Catalog Number: A24527
Alternative Catalog Number: ABB-A24527-20UL,ABB-A24527-100UL,ABB-A24527-500UL,ABB-A24527-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Ox-44, Tspan25, CD53
Predicted to enable identical protein binding activity. Involved in positive regulation of myoblast fusion. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system, brain, genitourinary system, hemolymphoid system gland, and liver and biliary system. Orthologous to human CD53 (CD53 molecule).
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 12508
UniProt: Q61451
Purity: Affinity purification
Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN
Target: Cd53
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of lysates from Mouse spleen, using CD53 Rabbit pAb (A24527) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.