Human IgG4/Immunoglobulin heavy constant gamma 4 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A24655
- Images (1)
| Article Name: | Human IgG4/Immunoglobulin heavy constant gamma 4 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A24655 |
| Supplier Catalog Number: | A24655 |
| Alternative Catalog Number: | ABB-A24655-20UL,ABB-A24655-100UL,ABB-A24655-500UL,ABB-A24655-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Synthetic peptide. This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | IGHG4, Ig gamma-4 chain C region, Human IgG4/Immunoglobulin heavy constant gamma 4 |
| Immunoglobulin G (IgG), is one of the most abundant protein in human serum with normal levels between 8-17 mg/ml in adult blood. IgG is important for our defence against microorganisms and the molecules are produced by B-lymphocytes as a part of our adaptive immune response. The IgG molecule has two separate functions, to bind to the pathogen that elicited the response and to recruit other cells and molecules to destroy the antigen. The variability of the IgG pool is generated by somatic recombination and the number of specificities in an individual at a given time point is estimated to be 1011 variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 44kDa |
| UniProt: | P01861 |
| Purity: | Affinity purification |
| Sequence: | VHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQED |
| Target: | Immunoglobulin heavy constant gamma 4 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human. ResearchArea: Immunology,Immunoglobulins,Heavy Chain,IgG. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using Human IgG4/Immunoglobulin heavy constant gamma 4 Rabbit pAb (A24655) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
