DVL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24657
Article Name: DVL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24657
Supplier Catalog Number: A24657
Alternative Catalog Number: ABB-A24657-20UL,ABB-A24657-100UL,ABB-A24657-500UL,ABB-A24657-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: DVL, DRS2, DVL1L1, DVL1P1, DVL1
DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 1855
UniProt: O14640
Purity: Affinity purification
Sequence: DEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTG
Target: DVL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:2000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,mTOR Signaling Pathway,Cell Biology Developmental Biology,Wnt-Catenin Signaling Pathway,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Mouse brain, using DVL1 Rabbit pAb (A24657) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.