MKP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24667
Article Name: MKP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24667
Supplier Catalog Number: A24667
Alternative Catalog Number: ABB-A24667-20UL,ABB-A24667-100UL,ABB-A24667-500UL,ABB-A24667-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HVH1, MKP1, CL100, MKP-1, PTPN10
The protein encoded by this gene is a phosphatase with dual specificity for tyrosine and threonine. The encoded protein can dephosphorylate MAP kinase MAPK1/ERK2, which results in its involvement in several cellular processes. This protein appears to play an important role in the human cellular response to environmental stress as well as in the negative regulation of cellular proliferation. Finally, the encoded protein can make some solid tumors resistant to both chemotherapy and radiotherapy, making it a target for cancer therapy.
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 1843
UniProt: P28562
Purity: Affinity purification
Sequence: TICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFESQVLAPHCSAEAGSPAMAVLDRGTSTTTVFNFPVSIPVHSTNSALSYLQSPITTSPSC
Target: DUSP1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,MAPK-Erk Signaling Pathway,MAPK-JNK Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates, using MKP1 Rabbit pAb (A24667) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):THP-1
Exposure time: 3s.