IGF1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24744
Article Name: IGF1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24744
Supplier Catalog Number: A24744
Alternative Catalog Number: ABB-A24744-100UL,ABB-A24744-20UL,ABB-A24744-1000UL,ABB-A24744-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IGF, MGF, IGFI, IGF-I, IGF1
The protein encoded by this gene is similar to insulin in function and structure and is a member of a family of proteins involved in mediating growth and development. The encoded protein is processed from a precursor, bound by a specific receptor, and secreted. Defects in this gene are a cause of insulin-like growth factor I deficiency. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein.
Clonality: Polyclonal
Concentration: WB
Molecular Weight: 22kDa
NCBI: 3479
UniProt: P05019
Purity: Affinity purification
Sequence: VCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGT
Target: IGF1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Growth factors. Shipping: Ice Bag
Western blot analysis of various lysates using IGF1 Rabbit pAb (A24744) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.