ACSM5 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24750
Article Name: ACSM5 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24750
Supplier Catalog Number: A24750
Alternative Catalog Number: ABB-A24750-20UL,ABB-A24750-100UL,ABB-A24750-1000UL,ABB-A24750-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Acsm5, ACSM5, MACS3
Predicted to enable fatty acid ligase activity and fatty-acyl-CoA synthase activity. Predicted to be involved in acyl-CoA metabolic process and fatty acid biosynthetic process. Predicted to be active in mitochondrial matrix.
Clonality: Polyclonal
Molecular Weight: 64kDa
NCBI: 54988
UniProt: Q6NUN0
Purity: Affinity purification
Sequence: APLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWL
Target: ACSM5
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer, Endocrine and Metabolic, Lipid Metabolism, Cardiovascular, Lipids, Fatty Acids. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with ACSM5 using ACSM5 Rabbit pAb (A24750) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:30s.