STAT6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24832
Article Name: STAT6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24832
Supplier Catalog Number: A24832
Alternative Catalog Number: ABB-A24832-100UL,ABB-A24832-20UL,ABB-A24832-1000UL,ABB-A24832-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: STAT6, D12S1644, IL-4-STAT, STAT6B, STAT6C, signal transducer and activator of transcription 6
The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 74kDa/81kDa/94kDa
NCBI: 6778
UniProt: P42226
Purity: Affinity purification
Sequence: QPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLRANPSW
Target: STAT6
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics & Nuclear Signaling,Transcription Factors,Signal Transduction,Immunology & Inflammation,IL-6 Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of various lysates using STAT6 Rabbit pAb (A24832) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.