LAP2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24875
Article Name: LAP2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24875
Supplier Catalog Number: A24875
Alternative Catalog Number: ABB-A24875-100UL,ABB-A24875-20UL,ABB-A24875-1000UL,ABB-A24875-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TMPO, CMD1T, LAP2, LEMD4, PRO0868, TP, thymopoietin
The protein encoded by this gene resides in the nucleus and may play a role in the assembly of the nuclear lamina, and thus help maintain the structural organization of the nuclear envelope. It may function as a receptor for the attachment of lamin filaments to the inner nuclear membrane. Mutations in this gene are associated with dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Clonality: Polyclonal
Molecular Weight: 38kDa/50kDa/75kDa
NCBI: 7112
UniProt: P42166
Purity: Affinity purification
Sequence: MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSS
Target: TMPO
Antibody Type: Primary Antibody
Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology & Developmental Biology,Cytoskeleton,Intermediate Filaments. Shipping: Ice Bag
Western blot analysis of lysates from Rat thymus usingLAP2 Rabbit pAb (A24875) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 135s.