RIPK2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2498
Article Name: RIPK2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2498
Supplier Catalog Number: A2498
Alternative Catalog Number: ABB-A2498-100UL,ABB-A2498-20UL,ABB-A2498-500UL,ABB-A2498-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CCK, RICK, RIP2, CARD3, GIG30, CARDIAK, RIPK2
This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 8767
UniProt: O43353
Purity: Affinity purification
Sequence: MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESL
Target: RIPK2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Kinase,Serine threonine kinases,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Caspases,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using RIPK2 Rabbit pAb (A2498) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.