RIPK2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A2498
- Images (1)
| Article Name: | RIPK2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A2498 |
| Supplier Catalog Number: | A2498 |
| Alternative Catalog Number: | ABB-A2498-100UL,ABB-A2498-20UL,ABB-A2498-500UL,ABB-A2498-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CCK, RICK, RIP2, CARD3, GIG30, CARDIAK, RIPK2 |
| This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli. |
| Clonality: | Polyclonal |
| Molecular Weight: | 61kDa |
| NCBI: | 8767 |
| UniProt: | O43353 |
| Purity: | Affinity purification |
| Sequence: | MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESL |
| Target: | RIPK2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Kinase,Serine threonine kinases,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Apoptosis,Caspases,Inhibition of Apoptosis,Death Receptor Signaling Pathway,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,NF-kB Signaling Pathway,Toll-like Receptor Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,TLR Signaling. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using RIPK2 Rabbit pAb (A2498) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
