Cytokeratin 14 (KRT14) Rabbit mAb, Unconjugated, Monoclonal

Article Name:	Cytokeratin 14 (KRT14) Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number:	ABB-A25205
Supplier Catalog Number:	A25205
Alternative Catalog Number:	ABB-A25205-100UL,ABB-A25205-20UL,ABB-A25205-500UL,ABB-A25205-1000UL
Manufacturer:	ABclonal
Host:	Rabbit
Category:	Antikörper
Application:	ELISA, IF, IHC-P, WB
Species Reactivity:	Human
Immunogen:	Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation:	Unconjugated
Alternative Names:	K14, NFJ, CK14, EBS1, EBS3, EBS4, EBS1A, EBS1B, EBS1C, EBS1D, Cytokeratin 14 (KRT14)

This gene encodes a member of the keratin family, the most diverse group of intermediate filaments. This gene product, a type I keratin, is usually found as a heterotetramer with two keratin 5 molecules, a type II keratin. Together they form the cytoskeleton of epithelial cells. Mutations in the genes for these keratins are associated with epidermolysis bullosa simplex. At least one pseudogene has been identified at 17p12-p11.

Clonality:	Monoclonal
Clone Designation:	[ARC66097]
Molecular Weight:	52kDa
NCBI:	3861
UniProt:	P02533
Purity:	Affinity purification
Sequence:	IQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Target:	KRT14
Antibody Type:	Primary Antibody

Application Dilute:	WB,1:3000 - 1:18000\|IF/ICC,1:200 - 1:2000\|IF-P,1:200 - 1:2000\|IHC-P,1:200 - 1:2000\|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes:	Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin. Shipping: Ice Bag

	Confocal imaging of A-431 cells usingCytokeratin 14 (KRT14) Rabbit mAb (A25205, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
	Confocal imaging of HaCat cells usingCytokeratin 14 (KRT14) Rabbit mAb (A25205, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
	Western blot analysis of various lysates usingCytokeratin 14 (KRT14) Rabbit mAb (A25205) at1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Negative control (NC):SH-SY5Y. Exposure time:1s.
	Confocal imaging ofparaffin-embedded mouse skin usingCytokeratin 14 (KRT14) Rabbit mAb (A25205, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
	Confocal imaging ofparaffin-embedded rat skin usingCytokeratin 14 (KRT14) Rabbit mAb (A25205, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
	Immunohistochemistry analysis of paraffin-embeddedHuman tonsil tissue usingCytokeratin 14 (KRT14) Rabbit mAb(A25205) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embeddedHuman esophagus tissue usingCytokeratin 14 (KRT14) Rabbit mAb(A25205) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.
	Immunohistochemistry analysis of paraffin-embeddedHuman breast tissue usingCytokeratin 14 (KRT14) Rabbit mAb(A25205) at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.