TRMT61A Rabbit mAb, Unconjugated, Monoclonal
Catalog Number:
ABB-A25353
- Images (8)
| Article Name: | TRMT61A Rabbit mAb, Unconjugated, Monoclonal |
| Biozol Catalog Number: | ABB-A25353 |
| Supplier Catalog Number: | A25353 |
| Alternative Catalog Number: | ABB-A25353-20UL,ABB-A25353-100UL,ABB-A25353-1000UL,ABB-A25353-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, IF, IHC-P, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | GCD14, TRM61, Gcd14p, hTRM61, C14orf172 |
| Enables mRNA (adenine-N1-)-methyltransferase activity. Involved in mRNA methylation. Predicted to be located in nucleoplasm. Predicted to be part of tRNA (m1A) methyltransferase complex. Predicted to be active in nucleus. |
| Clonality: | Monoclonal |
| Clone Designation: | [ARC66031] |
| Molecular Weight: | 31kDa |
| NCBI: | 115708 |
| UniProt: | Q96FX7 |
| Purity: | Affinity purification |
| Sequence: | MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNVRTVSLPPPDLGTGTD |
| Target: | TRMT61A |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:3000 - 1:12000|IF/ICC,1:200 - 1:800|IF-P,1:200 - 1:800|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag |
|
|
Immunohistochemistry analysis of paraffin-embeddedRat spleen tissue usingTRMT61A Rabbit mAb(A25353) at a dilution of 1:200 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedMouse brain tissue usingTRMT61A Rabbit mAb(A25353) at a dilution of 1:200 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Western blot analysis of various lysates using TRMT61A Rabbit mAb (A25353) at 1:3000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates / proteins: 25 µg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time:30s. |
|
|
Immunohistochemistry analysis of paraffin-embeddedHuman breast cancer tissue usingTRMT61A Rabbit mAb(A25353) at a dilution of 1:200 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedRat colon tissue usingTRMT61A Rabbit mAb(A25353) at a dilution of 1:200 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Immunohistochemistry analysis of paraffin-embeddedRat testis tissue usingTRMT61A Rabbit mAb(A25353) at a dilution of 1:200 (40x lens).High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining. |
|
|
Confocal imaging of PC-3 cells usingTRMT61A Rabbit mAb (A25353, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x. |
|
|
Confocal imaging ofparaffin-embedded Rat spleen tissue usingTRMT61A Rabbit mAb (A25353, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x. |
Product Guarantee and Expert Support
