Lif Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A25755
- Images (1)
| Article Name: | Lif Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A25755 |
| Supplier Catalog Number: | A25755 |
| Alternative Catalog Number: | ABB-A25755-100UL,ABB-A25755-20UL,ABB-A25755-500UL,ABB-A25755-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Mouse |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development, generation of neurons, and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system, central nervous system, cranium, early conceptus, and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine). |
| Clonality: | Polyclonal |
| Molecular Weight: | 22kDa |
| NCBI: | 16878 |
| UniProt: | P09056 |
| Purity: | Affinity purification |
| Sequence: | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
| Target: | Lif |
| Application Dilute: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse. ResearchArea: Immunology Innate Immunity Cytokines IL6 RelatedImmunology Innate Immunity Cytokines OtherCell Biology Cell Cycle Cell differentiationNeuroscience Neurology process NeurogenesisEpigenetics and Nuclear Signaling Transcription Cancer susceptibility Tumor SuppressorsCancer Cell cycle Cell differentiation. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Lif Rabbit pAb (A25755) at 1:1000 dilution incubated overnight at 4°C. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25 µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 40s. |
Product Guarantee and Expert Support
