Histone H2B Rabbit mAb, Unconjugated, Monoclonal

Catalog Number: ABB-A26075
Article Name: Histone H2B Rabbit mAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A26075
Supplier Catalog Number: A26075
Alternative Catalog Number: ABB-A26075-1000UL,ABB-A26075-500UL,ABB-A26075-100UL,ABB-A26075-20UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ChIP, ELISA, IHC-P, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: H2B, H2BE, H2BQ, GL105, H2B.1, H2BFQ, H2BGL105, H2B-GL105, HIST2H2BE, Formyl-Histone H2B-K108
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-dependent histone that is a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. The protein has antibacterial and antifungal antimicrobial activity.
Clonality: Monoclonal
Molecular Weight: 14 kDa
NCBI: 3017
UniProt: P62807
Purity: Affinity purification
Sequence: MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Target: H2BC21
Application Dilute: WB,1:7000 - 1:42000|IHC-P,1:5000 - 1:20000|ChIP,3 µg antibody for 5µg-10µg of Chromatin|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using Histone H2B Rabbit mAb (A26075) at 1:7000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Histone H2B Rabbit mAb (A26075) at a dilution of 1:6500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Western blot analysis of various lysates using Histone H2B Rabbit mAb (A26075) at 1:7000 dilution incubated at room temperature for 1.5 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using Histone H2B Rabbit mAb (A26075) at a dilution of 1:6500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Histone H2B Rabbit mAb (A26075) at a dilution of 1:6500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Chromatin immunoprecipitation was performed with 10 µg of cross-linked chromatin from HeLa cells, using 3 µg of Histone H2B Rabbit mAb (A26075) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.
Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using Histone H2B Rabbit mAb (A26075) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IHC staining.
Chromatin immunoprecipitation was performed with 10 µg of cross-linked chromatin from HeLa cells, using 3 µg of Histone H2B Rabbit mAb (A26075) and Rabbit IgG isotype control (AC042). The enrichment of immunoprecipitated DNA at different genomic loci was examined by quantitative PCR. The histogram compares the ratio of the immunoprecipitated DNA to the input at given loci.