TAZ Rabbit PolymAb, Unconjugated, Monoclonal

Catalog Number: ABB-A26425PM
Article Name: TAZ Rabbit PolymAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A26425PM
Supplier Catalog Number: A26425PM
Alternative Catalog Number: ABB-A26425PM-500UL,ABB-A26425PM-100UL,ABB-A26425PM-20UL,ABB-A26425PM-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IHC-P, IP, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: TAZ
Enables transcription coactivator activity. Involved in several processes, including hippo signaling, positive regulation of cell differentiation, and regulation of signal transduction. Located in cytosol and nuclear body.
Clonality: Monoclonal
Molecular Weight: 44kDa
NCBI: 25937
UniProt: Q9GZV5
Purity: Affinity purification
Sequence: MNPASAPPPLPPPGQQVIHVTQDLDTDLEALFNSVMNPKPSSWRKKILPESFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGAQHVRSHSSPASLQLGTGAGAAGSPAQQHAHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNLHPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQKLRLQRIQMERERIRMRQEELM
Target: WWTR1
Application Dilute: WB,1:1500 - 1:9000|IHC-P,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from Mouse lung using TAZ Rabbit PolymAb (A26425PM) at 1:3000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30 s.
Western blot analysis of lysates from HeLa cells using TAZ Rabbit PolymAb (A26425PM)at 1:3000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 45s.
Immunohistochemistry analysis of paraffin-embedded Rat lung tissue using TAZ Rabbit PolymAb (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using TAZ Rabbit PolymAb (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using TAZ Rabbit PolymAb (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using TAZ Rabbit PolymAb (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human colon tissue using TAZ Rabbit PolymAb (A26425PM) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer(pH 9.0) prior to IHC staining.
Immunoprecipitation of TAZ from 300 µg extracts of HeLa cells was performed using 0.5 µg of TAZ Rabbit PolymAb (A26425PM). Rabbit IgG isotype control (AC005) was used to precipitate the Control IgG sample. IP samples were eluted with 1x reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using TAZ Rabbit PolymAb (A26425PM) at a dilution of 1:1000.