S100A9 Rabbit PolymAb, Unconjugated, Monoclonal

Catalog Number: ABB-A26782PM
Article Name: S100A9 Rabbit PolymAb, Unconjugated, Monoclonal
Biozol Catalog Number: ABB-A26782PM
Supplier Catalog Number: A26782PM
Alternative Catalog Number: ABB-A26782PM-100UL,ABB-A26782PM-20UL,ABB-A26782PM-500UL,ABB-A26782PM-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: MIF, NIF, P14, CAGB, CFAG, CGLB, L1AG, LIAG, MRP14, 60B8AG, MAC387, S100-A9
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity.
Clonality: Monoclonal
Molecular Weight: 13kDa
NCBI: 6280
UniProt: P06702
Purity: Affinity purification
Sequence: MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK
Target: S100A9
Application Dilute: WB,1:1500 - 1:12000|IF-P,1:200 - 1:800|IHC-P,1:500 - 1:10000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Tumor biomarkers,Signal Transduction,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using S100A9 Rabbit PolymAb (A26782PM) at 1:3000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): RAW 264.7
Exposure time: 15s.
Western blot analysis of various lysates using S100A9 Rabbit PolymAb (A26782PM) at 1:3000 dilutionincubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Jurkat
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human esophagus tissue using S100A9 Rabbit PolymAb (A26782PM) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using S100A9 Rabbit PolymAb (A26782PM) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using S100A9 Rabbit PolymAb (A26782PM) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using S100A9 Rabbit PolymAb (A26782PM) at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Rat spleen tissue using S100A9 Rabbit PolymAb (A26782PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.
Confocal imaging of paraffin-embedded Mouse spleen tissue using S100A9 Rabbit PolymAb (A26782PM, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.